Asclepias
Pregnanes
Apocynaceae
Glycosides
Any compound that contains a constituent sugar, in which the hydroxyl group attached to the first carbon is substituted by an alcoholic, phenolic, or other group. They are named specifically for the sugar contained, such as glucoside (glucose), pentoside (pentose), fructoside (fructose), etc. Upon hydrolysis, a sugar and nonsugar component (aglycone) are formed. (From Dorland, 28th ed; From Miall's Dictionary of Chemistry, 5th ed)
Metschnikowia vanudenii sp. nov. and Metschnikowia lachancei sp. nov., from flowers and associated insects in North America. (1/23)
Two new species of the ascosporic yeast genus Metschnikowia were isolated from nectaries and associated muscoid flies of flowers from the common milkweed (Asclepias syriaca) in North America, and are described as Metschnikowia vanudenii [type strain=PYCC 4650(T)=CBS 9134(T)=NRRL Y-27243(T)=UWO(PS) 86A4.1(T)] and Metschnikowia lachancei [type strain=PYCC 4605(T)=CBS 9131(T)=NRRL Y-27242(T)=UWO(PS) 7ASB2.3(T)]. As with the previously described Metschnikowia gruessii, M. vanudenii has vegetative cells with an 'aeroplane' or cross-like configuration, produces ovoid chlamydospores and forms ellipsoidopedunculate asci with two acicular ascospores. Metschnikowia lachancei is distinguished from other Metschnikowia species by formation of club-shaped asci with 1-2 thick clavate ascospores. The phylogenetic positions of the proposed new species within Metschnikowia were determined from sequence analysis of the D1/D2 domain of 26S rDNA. The new species show low nuclear DNA relatedness with neighbouring taxa. (+info)Flavonoids in the leaves of Asclepias incarnata L. (2/23)
Seven flavonoid compounds: quercelin 3-O-beta-galactopyranoside, 3-O-beta-glucopyranoside, 3-O-arabinoside, 3-O-beta-glucopyranosyl (1-->2)-beta-galactopyranoside, 3-O-beta-xylopyranosyl (1-->2)-beta-galactopyranoside, 3-O-alpha-rhamnopyranosyl (1-->2)-beta-galactopyranoside and kaempferol 3-beta-glucopyranoside were isolated and identified from the leaves of Asclepias incarnata, L. (Asclepiadaceae). (+info)Steroidal glycosides from the roots of Asclepias curassavica. (3/23)
Twenty-six new acylated-oxypregnane glycosides were obtained along with three known cardenolide glycosides from the roots of Asclepias curassavica (Asclepiadaceae). The new compounds were confirmed to contain 12-O-benzoylsarcostin, 12-O-benzoyldeacylmetaplexigenin, kidjolanin, and 12-O-benzoyltayloron, and one new acylated-oxypregnane, 12-O-(E)-cinnamoyltayloron, as their aglycones, using both spectroscopic and chemical methods. (+info)Phylogenetic escalation and decline of plant defense strategies. (4/23)
(+info)New cardenolide and acylated lignan glycosides from the aerial parts of Asclepias curassavica. (5/23)
Three new cardenolide glycosides and six new acylated lignan glycosides were obtained along with nineteen known compounds from the aerial parts of Asclepias curassavica L. (Asclepiadaceae). The structure of each compound was determined based on interpretations of NMR and MS measurements and chemical evidence. (+info)Acylated-oxypregnane glycosides from the roots of Asclepias syriaca. (6/23)
Twenty new pregnane glycosides were obtained from the roots of Asclepias syriaca L. (Asclepiadaceae). These glycosides were confirmed to contain ikemagenin, 12-O-nicotinoyllineolon, 5alpha,6-dihydroikemagenin, and 12-O-tigloylisolineolon, as their aglycones, using both spectroscopic and chemical methods. (+info)Biochemical analysis of a papain-like protease isolated from the latex of Asclepias curassavica L. (7/23)
Most of the species belonging to Asclepiadaceae family usually secrete an endogenous milk-like fluid in a network of laticifer cells in which sub-cellular organelles intensively synthesize proteins and secondary metabolites. A new papain-like endopeptidase (asclepain c-II) has been isolated and characterized from the latex extracted from petioles of Asclepias curassavica L. (Asclepiadaceae). Asclepain c-II was the minor proteolytic component in the latex, but showed higher specific activity than asclepain c-I, the main active fraction previously studied. Both enzymes displayed quite distinct biochemical characteristics, confirming that they are different enzymes. Crude extract was purified by cation exchange chromatography (FPLC). Two active fractions, homogeneous by sodium dodecyl sulphate-polyacrylamide gel electrophoresis and mass spectrometry, were isolated. Asclepain c-II displayed a molecular mass of 23,590 Da, a pI higher than 9.3, maximum proteolytic activity at pH 9.4-10.2, and showed poor thermostability. The activity of asclepain c-II is inhibited by cysteine proteases inhibitors like E-64, but not by any other protease inhibitors such as 1,10-phenantroline, phenylmethanesulfonyl fluoride, and pepstatine. The Nterminal sequence (LPSFVDWRQKGVVFPIRNQGQCGSCWTFSA) showed a high similarity with those of other plant cysteine proteinases. When assayed on N-alpha-CBZ-amino acid-p-nitrophenyl esters, the enzyme exhibited higher preference for the glutamine derivative. Determinations of kinetic parameters were performed with N-alpha-CBZ-L-Gln-p-nitrophenyl ester as substrate: K(m)=0.1634 mM, k(cat)=121.48 s(-1), and k(cat)/K(m)=7.4 x 10(5) s(-1)/mM. (+info)Aerial reproductive structures of vascular plants as a microhabitat for myxomycetes. (8/23)
This study explored the occurrence and distribution of myxomycete species on the aerial reproductive structures of vascular plants. Eight species of vascular plants representing five families were sampled. The doubled rope climbing method was used to collect bark and cones from the canopy of Pinus echinata. Bark and aerial seed pods were gathered from Cercis canadensis, follicles and stems from Asclepias syriaca, dried composite inflorescences and stems from Echinacea angustifolia, E. pallida, and E. paradoxa var. paradoxa, and capsules and stems from Yucca glauca and Y. smalliana. Reproductive structures and bark/stems for 202 host plants were separated and cultured in 541 moist chambers, resulting in 118 collections yielding 32 myxomycete species representing 11 genera, seven families and five orders. There was no significant difference in pH values of the reproductive structures and bark/stems of the host plants, however legume pods of C. canadensis (6.9 +/- 1.3) had higher pH than the bark (6.0 +/- 1.1) and had a different composition of myxomycete species. Myxomycete orders have optimal pH ranges. Nonmetric multidimensional scaling, multiresponse permutation procedure and indicator species analysis showed a significant difference in species richness of reproductive structures and bark/stems. The bark of trees had greater mean species richness of myxomycetes than the reproductive structures, but the reproductive structures of herbaceous plants had greater mean species richness of myxomycetes than the stems. A new term, herbicolous myxomycetes, is proposed for a group of myxomycetes frequently associated with herbaceous, perennial, grassland plants. An undescribed species of Arcyria occurred only on cones of P. echinata. (+info)Asclepias is a genus of flowering plants in the dogbane family Apocynaceae, commonly known as milkweeds, characterized by milky latex sap, opposite leaves, and variously shaped flowers with five lobes that produce unique seedpods containing silky-haired seeds.
"Asclepias" is a genus of plants in the dogbane family (Apocynaceae). It includes several species commonly known as milkweeds. These plants are native to North America and are known for their milky sap and clusters of pink, yellow, or white flowers. Some species of Asclepias are important host plants for the monarch butterfly, which lays its eggs on the leaves and uses the sap to fuel its migration.
Pregnanes are steroid hormones or their precursors that contain a pregnane skeleton, which is a chemical structure consisting of four fused cyclohexane rings, and are biosynthesized from cholesterol, playing crucial roles in various physiological processes including pregnancy and fetal development.
Pregnanes are a class of steroid hormones and steroids that contain a pregnane nucleus, which is a steroid core with a carbon skeleton consisting of 21 carbons. This structure includes four fused rings, labeled A through D, and is derived from cholesterol.
Pregnanes are important precursors for the synthesis of various steroid hormones in the body, including progesterone, which plays a crucial role in maintaining pregnancy and regulating the menstrual cycle. Other examples of pregnanes include cortisol, a stress hormone produced by the adrenal gland, and aldosterone, a hormone that helps regulate electrolyte balance and blood pressure.
It's worth noting that pregnanes can also refer to synthetic compounds that contain this steroid nucleus and are used in various medical and research contexts.
Apocynaceae is a family of flowering plants that include species with milky sap, simple or compound leaves, and showy flowers, some of which contain cardiac glycosides and are used in traditional medicine and as ornamentals, such as oleander, periwinkle, and dogbane.
Apocynaceae is a family of flowering plants that includes shrubs, trees, and vines. It's also known as the dogbane or milkweed family. The plants in this family have milky sap and contain toxic compounds, which can be harmful or even fatal to animals and humans if ingested. Some well-known members of Apocynaceae include the various species of milkweeds (Asclepias spp.), oleander (Nerium oleander), and periwinkle (Vinca spp.).
The family is characterized by having opposite leaves, flowers with five petals and five sepals, and a superior ovary. The fruits are usually paired follicles that contain numerous seeds with tufts of hair to aid in wind dispersal. Many species in this family have medicinal or toxic properties, and some have economic importance as ornamental plants, sources of fiber, or for their use in traditional medicine.
Glycosides are organic compounds consisting of a aglycone (non-sugar) part and a glycone (sugar) part, typically formed via a glycosidic bond, which can have various pharmacological effects depending on the type of glycoside.
Glycosides are organic compounds that consist of a glycone (a sugar component) linked to a non-sugar component, known as an aglycone, via a glycosidic bond. They can be found in various plants, microorganisms, and some animals. Depending on the nature of the aglycone, glycosides can be classified into different types, such as anthraquinone glycosides, cardiac glycosides, and saponin glycosides.
These compounds have diverse biological activities and pharmacological effects. For instance:
* Cardiac glycosides, like digoxin and digitoxin, are used in the treatment of heart failure and certain cardiac arrhythmias due to their positive inotropic (contractility-enhancing) and negative chronotropic (heart rate-slowing) effects on the heart.
* Saponin glycosides have potent detergent properties and can cause hemolysis (rupture of red blood cells). They are used in various industries, including cosmetics and food processing, and have potential applications in drug delivery systems.
* Some glycosides, like amygdalin found in apricot kernels and bitter almonds, can release cyanide upon hydrolysis, making them potentially toxic.
It is important to note that while some glycosides have therapeutic uses, others can be harmful or even lethal if ingested or otherwise introduced into the body in large quantities.
Asclepias
... such as Asclepias fascicularis, Asclepias tuberosa, and Asclepias angustifolia.[citation needed] The leaves of Asclepias ... "Asclepias L." Plants of the World Online. Royal Botanical Gardens, Kew. Retrieved 2018-11-23. "Asclepias". ipni.org. ... 191-198 Asclepias subverticillata (A. Gray) Vail, USDA PLANTS "GRIN Species Records of Asclepias". Germplasm Resources ... Asclepias is a genus of herbaceous, perennial, flowering plants known as milkweeds, named for their latex, a milky substance ...
Asclepias sullivantii
Wikimedia Commons has media related to Asclepias sullivantii. Asclepias sullivantii. Missouri Botanical Garden. "Asclepias ... Asclepias sullivantii is a species of flowering plant in the milkweed genus, Asclepias. Common names include prairie milkweed, ... The original range of Asclepias sullivantii was the tall grass prairie, but very little of that habitat remains because of wide ... This species is very similar to Asclepias syriaca, the common milkweed, and the two easily hybridize. Common milkweed can be ...
Asclepias stenophylla
"Plants Profile for Asclepias stenophylla (slimleaf milkweed)". plants.usda.gov. Retrieved 2020-12-05. "Asclepias stenophylla A ... Asclepias stenophylla is a herbaceous perennial growing from a carrot-like or tuberous, vertical root that is 3 to 10 dm long. ... Asclepias stenophylla is found in dry prairies; and also in loess and gravel prairies. In Minnesota it has been found growing ... "Asclepias stenophylla A.Gray , Plants of the World Online , Kew Science". Plants of the World Online. Retrieved 2020-12-05. " ...
Asclepias solanoana
"NatureServe Explorer - Asclepias solanoana". NatureServe Explorer Asclepias solanoana. NatureServe. 2022-05-30. Retrieved 30 ... "TPL, treatment of Asclepias solanoana". The Plant List; Version 1. (published on the internet). Royal Botanic Gardens, Kew and ... Asclepias solanoana is a rare species of milkweed known by the common names serpentine milkweed, prostrate milkweed, and ... Asclepias, Endemic flora of California, Natural history of the California Coast Ranges, Natural history of Sonoma County, ...
Asclepias prostrata
... , commonly known as prostrate milkweed, is a species of perennial plant in the genus Asclepias. It has ... Ascelpias bifida and Asclepias prostrata. Southwest Naturalist 9(3): 171-180. "Asclepias prostrata". Plants of the World Online ... Synopsis of the 23 species of Asclepias (Asclepiadaceae) in Tamaulipas and Nuevo Leon including 2 new species, ... v t e (NatureServe critically imperiled species, Articles with 'species' microformats, Asclepias, Flora of Texas, North ...
Asclepias subverticillata
... is a plant found in the southwestern United States and Mexico. Common names include horsetail ... ISBN 978-0-375-40233-3. "Plants Profile for Asclepias subverticillata (horsetail milkweed)". plants.usda.gov. Retrieved 2019-10 ... Asclepias, Fiber plants, Flora of the United States, Plants used in Native American cuisine, All stub articles, Apocynaceae ...
Asclepias humistrata
... , the sandhill milkweed, is a species of milkweed plant. It is also known as pinewoods milkweed and pink- ... Wikispecies has information related to Asclepias humistrata. v t e (Articles with short description, Short description matches ... ISBN 0-395-96609-4 Wikimedia Commons has media related to Asclepias humistrata. ... Asclepias, Flora of Alabama, Flora of Florida, All stub articles, Apocynaceae stubs). ...
Asclepias subulata
Jepson Manual Treatment for Asclepias subulata Asclepias subulata - UC Photo gallery v t e (Articles needing additional ... Asclepias subulata is a species of milkweed known commonly as the rush milkweed, desert milkweed or ajamete. This is an erect ... Asclepias subulata is a larval host for the monarch butterfly. Kirti Mathura. "The Master Gardner Journal". Cooperative ... Beckett, R. E.; Stitt, R.S. (May 1935). "The Desert Milkweed (Asclepias subulata) as a possible source of natural rubber". ...
Asclepias albicans
... is a species of milkweed known by the common names whitestem milkweed and wax milkweed. It is native to the ... Asclepias albicans is a larval host for the monarch butterfly and the queen butterfly. The similar A. subulata is found in ... Asclepias, Flora of the California desert regions, Flora of Arizona, Flora of Baja California, Flora of the Sonoran Deserts, ...
Asclepias mexicana
Asclepias Bifida and Asclepias Prostrata". The Southwestern Naturalist. 9 (3): 171-180. doi:10.2307/3669574. JSTOR 3669574. ... Asclepias Bifida and Asclepias Prostrata". The Southwestern Naturalist. 9 (3): 171-180. doi:10.2307/3669574. JSTOR 3669574. ... Asclepias mexicana grows in the western United States and Mexico. It has been found in the U.S. in California, Washington, ... Carr, Katherine (1942). "A Key to the North American Species of Asclepias, without Fruit or Color Characters". Castanea. 7 (1 ...
Asclepias meadii
... is a rare species of milkweed known by the common name Mead's milkweed. It is native to the American Midwest, ... This behavior can be seen in multiple milkweed species, such as Asclepias syriaca. "The Nature Conservancy". Archived from the ... Betz, R. F. (1989). Ecology of Mead's milkweed (Asclepias meadii) Torrey. in Proceedings of the 11th North American Prairie ... 2005). Factors limiting fruit production in Asclepias meadii in northeastern Kansas. American Midland Naturalist 153:2 245. ...
Asclepias nivea
... , the Caribbean milkweed, is a species of milkweed. It belongs in the subfamily Asclepiadoideae. It is native to ... Wikispecies has information related to Asclepias nivea. v t e (Articles with short description, Short description matches ... Wikidata, Articles with 'species' microformats, Asclepias, Plants described in 1753, Taxa named by Carl Linnaeus, All stub ...
Asclepias angustifolia
"Asclepias angustifolia, Arizona Milkweed, Southwest Desert Flora". southwestdesertflora.com. Retrieved 2020-12-16. "Asclepias ... "Asclepias angustifolia Schweigg". www.gbif.org. GBIF. Retrieved 2020-12-17. "Taxonomy browser (Asclepias angustifolia)". www. ... Asclepias angustifolia, commonly called the Arizona milkweed , is an endemic species of milkweed native only to Arizona. The ... Cold hardiness has been noted to −12 °C (10 °F). Asclepias angustifolia pollination is performed mechanically by insects. ...
Asclepias connivens
... is a species of milkweed, commonly called Baldwin's milkweed or the largeflower milkweed. It is an obligate ... Retrieved 2019-08-27.{{cite web}}: CS1 maint: archived copy as title (link) "Asclepias connivens - Species Details". Florida. ... "Native Florida Wildflowers: Largeflower Milkweed - Asclepias connivens". Hawthornhillwildflowers.blogspot.com. February 25, ... Asclepias, Flora of Alabama, Flora of Georgia (U.S. state), Flora of Florida). ...
Asclepias cinerea
"Milkweed (Asclepias cinerea), a Comprehensive Guide in 10 Sections". McMullen House, 23 February 2023, "Asclepias cinerea". ... Asclepias cinerea is a perennial herb that is grass-like in appearance with a thin, smooth stem that reaches 2 ft (0.61 m) in ... Asclepias cinerea, also known as Carolina milkweed or ashy milkweed, is a herbaceous perennial plant species in the genus ... "NatureServe Explorer 2.0". Marcus, Joseph A. "Asclepias cinerea" Lady Bird Johnson Wildflower Center, Plant Database, 14 August ...
Asclepias viridiflora
... is an erect to ascending herb up to 50 cm tall, with distinctive greenish-white flowers. The pods lack ... Asclepias viridiflora, is commonly known as green comet milkweed, green-flower milkweed, and green milkweed. It is a widely ... "Asclepias viridiflora". World Checklist of Selected Plant Families. Royal Botanic Gardens, Kew - via The Plant List. Note that ... "Asclepias viridiflora". Native Plant Database. Lady Bird Johnson Wildflower Center, University of Texas at Austin. Rafinesque. ...
Asclepias amplexicaulis
... , the blunt-leaved milkweed, clasping milkweed, or sand milkweed, is a species of flowering plant in the ... "Asclepias amplexicaulis". County-level distribution map from the North American Plant Atlas (NAPA). Biota of North America ... Media related to Asclepias amplexicaulis at Wikimedia Commons (Articles with short description, Short description is different ... In flower at Nachusa Grasslands in Illinois Line drawing USDA, NRCS (n.d.). "Asclepias amplexicaulis". The PLANTS Database ( ...
Asclepias lanuginosa
... , the woolly milkweed or sidecluster milkweed, is a species of flowering plant in the dogbane family, ... "Asclepias lanuginosa Nutt". Plants of the World Online. Royal Botanical Gardens Kew. Retrieved 2018-11-23. Wilhelm, Gerould; ... "Asclepias lanuginosa Nutt". ipni.org. International Plant Names Index. Retrieved 2018-11-23. "Lady Bird Johnson Wildflower ... USDA, NRCS (n.d.). "Asclepias lanuginosa". The PLANTS Database (plants.usda.gov). Greensboro, North Carolina: National Plant ...
Asclepias exaltata
ISBN 0-395-96609-4. Media related to Asclepias exaltata at Wikimedia Commons Data related to Asclepias exaltata at Wikispecies ... Asclepias exaltata (poke milkweed or tall milkweed) is a species of flowering plant in the dogbane family, native to eastern ... Maiz-Tome, L. (2016). "Asclepias exaltata". The IUCN Red List of Threatened Species. IUCN. 208. e.T64264135A67728538. doi: ... Asclepias, Flora of Northern America, Plants described in 1753, Taxa named by Carl Linnaeus, All stub articles, Apocynaceae ...
Asclepias syriaca
It is in the genus Asclepias, the milkweeds. It grows in sandy soils as well as other kinds of soils in sunny areas. A. syriaca ... Asclepias syriaca L. (common milkweed) is known to contain sufficient amounts of cardiac glycosides, which are known to be ... "Common Milkweed (Asclepias syriaca L.)". Plant of the Week. United States Department of Agriculture: United States Forest ... Asclepias syriaca, commonly called common milkweed, butterfly flower, silkweed, silky swallow-wort, and Virginia silkweed, is a ...
Asclepias viridula
... , commonly known as southern milkweed, is a species of milkweed (Asclepias) genus in the Apocynaceae family. ... "ITIS - Report: Asclepias viridula". www.itis.gov. "Lady Bird Johnson Wildflower Center - The University of Texas at Austin". ... v t e (Articles with short description, Short description matches Wikidata, Articles with 'species' microformats, Asclepias, ...
Asclepias longifolia
... , the longleaf milkweed, is a flowering plant native to the southern United States from Texas to Delaware. ... "Asclepias longifolia Michx". Plants of the World Online. Royal Botanic Gardens, Kew. Retrieved 8 February 2020. "Comprehensive ... v t e (Articles with short description, Short description matches Wikidata, Articles with 'species' microformats, Asclepias, ... Report Species - Asclepias longifolia". explorer.natureserve.org. Retrieved 8 February 2020. ...
Asclepias pedicellata
... is a type of milkweed. A perennial herb, it has yellow or green flowers. Its common name is savannah ... http://florida.plantatlas.usf.edu/Plant.aspx?id=3188 Asclepias pedicellata Florida Plant Atlas (Articles with short description ... Short description matches Wikidata, Articles with 'species' microformats, Asclepias, Perennial plants). ...
Asclepias texana
Pollinator Plants of the Desert Southwest: Native Milkweeds (Asclepias spp) United States Department of Agriculture "Asclepias ... Asclepias texana is a shrubby perennial, growing to ~2 feet tall. It produces bright white flowers in the summer. USDA, NRCS (n ... Asclepias texana, commonly called Texas milkweed, is a species of flowering plant in the dogbane family (Apocynaceae). It is ... v t e (Articles with short description, Short description matches Wikidata, Articles with 'species' microformats, Asclepias, ...
Asclepias tomentosa
... , common name tuba milkweed, is a flowering plant in the milkweed family. It is indigenous to parts of ... Asclepias, Plants described in 1817, Taxa named by Stephen Elliott, All stub articles, Apocynaceae stubs). ...
Asclepias quadrifolia
"Asclepias quadrifolia (four-leaved milkweed): Go Botany". gobotany.nativeplanttrust.org. "Asclepias quadrifolia (Four-Leaved ... Most Asclepias are toxic if consumed in large quantities due to cardiac glycoside and resinoid content. Fourleaf milkweed is ... Asclepias quadrifolia, commonly called four-leaved milkweed or fourleaf milkweed, is a species of milkweed in the Apocynaceae ( ... "Fourleaf Milkweed (Asclepias quadrifolia)". Dave's Garden. Archived from the original on 2016-01-01. Retrieved 2015-09-19. ...
Asclepias hirtella
Asclepias longifolia is restricted to the Southeastern Coastal Plain, and it differs from Asclepias hirtella in its fewer and ... Hilty, John (2020). "Asclepias hirtella". Illinois Wildflowers. USDA, NRCS (n.d.). "Asclepias hirtella". The PLANTS Database ( ... Asclepias hirtella, commonly called the tall green milkweed, is a species of flowering plant in the milkweed genus and dogbane ... Asclepias hirtella is found in a variety of open habitats, including areas with dry sandy soil, prairies and limestone glades, ...
Asclepias linaria
... is a species of milkweed known by the common name pineneedle milkweed. It is native to the Mojave and Sonoran ... Asclepias linaria is a larval host for the monarch butterfly. Research indicates that the very high cardenolide content of this ... By contrast, some species of Asclepias are extremely poor sources of cardenolides. Morris, Gail M.; Kline, Christopher; Morris ... Wikimedia Commons has media related to Asclepias linaria. Jepson Manual Treatment v t e (Articles needing additional references ...
Asclepias viridis
"Asclepias viridis Green antelopehorn" (PDF). Pollinator Plants of the Central United States: Native Milkweeds (Asclepias spp ... Asclepias viridis is a species of milkweed, a plant in the dogbane family known by the common names green milkweed, green ... "Asclepias viridis". Native Plant Database. Lady Bird Johnson Wildflower Center, University of Texas at Austin. Van Hook, T. and ... "Green Antelopehorn (Asclepias viridis)". Plant of the Week. Washington, D.C.: United States Department of Agriculture: United ...
Asclepias asperula
... , commonly called antelope horns milkweed or spider milkweed, is a species of milkweed native to the ... Asclepias asperula does not self-pollinate so they are dependent on attracting pollinators that will transfer pollen between ... Asclepias asperula is divided into two subspecies: A. asperula. ssp. asperula and A. asperula ssp. capricornu. Ssp. capricornu ... "Asclepias asperula ssp. capricornu". Lady Bird Johnson Wildflower Center. The University of Texas at Austin. 2019. Retrieved 21 ...
Incarnata3
- Red Milkweed ( Asclepias incarnata ) plants grow 3- to 5-feet tall and produce bright clusters of pink flowers that bloom throughout the summer. (planetnatural.com)
- The photographer's identification Asclepias incarnata has not been reviewed. (berkeley.edu)
- Asclepias incarnata, more commonly known as swamp milkweed , is a native perennial found throughout most of the United States. (tnnursery.net)
Curassavica9
- Dear All, asclepias curassavica is common plant now,rather a weed in Maharashtra specially around Pune.Abundandly available in marshy places. (google.com)
- Asclepias curassavica Lour. (wikimedia.org)
- Asclepias curassavica , commonly known as tropical milkweed , [3] is a flowering plant species of the milkweed genus, Asclepias . (wikipedia.org)
- Planting Asclepias curassavica in nonnative regions therefore remains controversial and criticized. (wikipedia.org)
- Asclepias curassavica is sometimes used in butterfly gardens (see above for concerns for monarchs) or as a cut flower. (wikipedia.org)
- Asclepias curassavica is described by NatureServe as a "widespread species, ranging from southern North America through Central America and into South America. (wikipedia.org)
- Asclepias curassavica was introduced to Australia prior to 1869 and is widespread in parts of Queensland. (wikipedia.org)
- Asclepias curassavica contains several cardiac glycosides , [17] including asclepin, [18] calotropin, uzarin and their free genins, calactin, coroglucigenin and uzarigenin. (wikipedia.org)
- The most abundant cardiac glycoside present in Asclepias curassavica leaves is voruscharin, which comprises around 40% of the total cardiac glycoside content in leaves. (wikipedia.org)
Tuberosa6
- If you live in Chicago you can plant Mexican species (Asclepias mexicana) or Asclepias tuberosa, don't plant our species. (laspilitas.com)
- Asclepias tuberosa , Butterfly Weed, is most often a distinctive bright orange but there is some variation in flower color, from deep red-orange to yellow. (prairiemoon.com)
- Like all species in the Asclepias genus, Asclepias tuberosa is one of the larval host plants for the monarch butterfly. (prairiemoon.com)
- When direct seeding asclepias tuberosa in the fall , do you cover the seeds or leave them uncovered? (prairiemoon.com)
- Asclepias tuberosa 'Hello Yellow' (30)ct Flat Common Name: Butterfly Weed, pleurisy root. (bloomindesigns.com)
- Asclepias tuberosa (25) Bare Root PlantsCommon Name: Butterfly Weed A virtually hassle-free, very long lived perennial, offering three months of tangerine orange blooms (occasionally red or yellow) from early through late summer. (bloomindesigns.com)
Genus2
- Asclepias is a genus of herbaceous, perennial, flowering plants known as milkweeds, named for their latex, a milky substance containing cardiac glycosides termed cardenolides, exuded where cells are damaged. (wikipedia.org)
- The size, shape and color of the horns and hoods are often important identifying characteristics for species in the genus Asclepias. (wikipedia.org)
Species4
- Asclepias species produce their seeds in pods termed follicles. (wikipedia.org)
- This is the most widespread species of Asclepias in South Africa. (plantzafrica.com)
- This widespread species of Asclepias is varied over its range and a number of distinct ecotypes can be observed. (plantzafrica.com)
- A long-lived perennial herb in the milkweed family ( Asclepiadaceae ), Mead's milkweed ( Asclepias meadii ) is a federally threatened species. (fws.gov)
Syriaca3
- Once thought of a weed by the wayside, the common milkweed (Asclepias syriaca) is now recognized as a vital link in our increasingly fragile ecosystem. (snagmetalsmith.org)
- Common Milkweed ( Asclepias syriaca ) - Flowers are different, grows in more open habitat, leaves are more rounded at end. (ontariowildflowers.com)
- Uncommon, easily overlooked, often confused with Common Milkweed ( Asclepias syriaca ) . (ontariowildflowers.com)
Asclepiadaceae1
- Asclepias (ass- kleep -ee-ass), Milkweed, Milkweed Family (Asclepiadaceae). (bloomindesigns.com)
Asperula3
- Asclepias asperula is a widespread US native that can be found on dry sandy/gravelly soils from Oklahoma west to Southern California. (plantdelights.com)
- But a search of the USDA Plants Database listing for spider milkweed turns up a different milkweed, Asclepias asperula . (naba.org)
- Asclepias asperula has a native range from Texas north to Nebraska and Idaho and extending westward to California. (naba.org)
Monarchs1
- In Texas, Asclepias viridis is quite common and is considered an important food source for the Monarchs as they start their spring migration northward. (naba.org)
Viridis1
- Asclepias viridis , listed as Green Antelopehorn by the USDA Plants Database, is also called spider milkweed by many sources. (naba.org)
Speciosa9
- In our area Asclepias speciosa is covered with monarch caterpillars during the summer. (laspilitas.com)
- Asclepias speciosa is similar to Asclepias eriocarpa , but taller and less fuzzy leaves, and much more fragrant. (laspilitas.com)
- Asclepias speciosa tolerates clay. (laspilitas.com)
- Asclepias speciosa is great for a bird garden and a butterfly garden. (laspilitas.com)
- Foliage of Asclepias speciosa has color silver and is deciduous. (laspilitas.com)
- Flower of Asclepias speciosa has color pink. (laspilitas.com)
- Communities for Asclepias speciosa:Mixed-evergreen Forest and Yellow Pine Forest. (laspilitas.com)
- Asclepias speciosa Torr. (wa.gov.au)
- Home » Organism Search » Asclepias speciosa Torr. (wa.gov.au)
Ovalifolia1
- Asclepias ovalifolia, commonly known as Oval-leaf Milkweed, is a stunning perennial plant that can grow up to 0.6m by 1m. (sheffields.com)
Monarch1
- Large-bodied hymenopterans (bees, wasps) are the most common and best pollinators, accounting for over 50% of all Asclepias pollination, whereas monarch butterflies are poor pollinators of milkweed. (wikipedia.org)
Herbaceous1
- Asclepias are herbaceous perennials, scrambling or twining, often succulents with watery or milky sap. (plantzafrica.com)
Grows1
- Asclepias incarnate grows in upright clumps of fleshy white tubers. (tnnursery.net)
Asklepios2
- Asclepias is dedicated to Asklepios, the Greek god of medicine. (plantzafrica.com)
- Asclepias is named for the Greek god of healing Asklepios, while viridiflora means with green flowers. (vplants.org)
Plant2
- Asclepias are rarely cultivated other than in native plant gardens and natural areas. (plantzafrica.com)
- It is quite drought tolerant,(not in the same league though as Asclepias A. eriocarpa, erosa or californica ) plant, water well first summer and ignore. (laspilitas.com)
Apocynaceae1
- Asclepias pygmaea is a species of in the family Apocynaceae . (eol.org)
Perennial3
- Prairie Milkweed (Asclepias sullivanti) is a native perennial with big personality, making a striking addition to butterfly gardens and is perfect for naturalizing in meadows. (americanmeadows.com)
- Asclepias asperula is a PERENNIAL growing to 1 m (3ft 3in) by 1 m (3ft 3in) at a medium rate. (pfaf.org)
- Asclepias arenaria, Sandhill Milkweed, is a unique perennial native to sandy habitats. (plantflowerseeds.com)
Subulata3
Californica5
- Asclepias californica, California milkweed is one of the most beautiful milkweeds in California. (laspilitas.com)
- Asclepias californica tolerates sand. (laspilitas.com)
- Foliage of Asclepias californica has color gray and is stressdeciduous. (laspilitas.com)
- Flower of Asclepias californica has color violet. (laspilitas.com)
- Communities for Asclepias californica:Chaparral, Mixed-evergreen Forest, Pinyon-Juniper Woodland and Yellow Pine Forest. (laspilitas.com)
Seeds1
- Asclepias species produce their seeds in pods termed follicles. (wikipedia.org)
Torr2
- Asclepias erosa Torr. (berkeley.edu)
- Asclepias meadii Torr. (scientificlib.com)
Decumbens1
- Asclepias decumbens. (bvsalud.org)
Milkweeds1
- A group of bioactive steroidal glycosides (pregnanes) with anorectic activity in animals was isolated from several genera of milkweeds including Hoodia and Asclepias. (nih.gov)
Butterflies1
- Prairie Milkweed (Asclepias) is a hummingbird favorite and ideal pollinator plant, attracting a wide variety of bees and butterflies to the garden. (americanmeadows.com)
Butterfly1
- With a Backdrop of Golden Clethra alnifolia and Side-Show of Blackened Rudbeckia Pom Poms, Glistening Asclepias tubersoa (Butterfly Weed), Parachutes Await a Breeze Some things in life are one-hit wonders, and others are worth a second thought or three. (thegardenerseden.com)
Names1
- Possible aliases, alternative names and misspellings for Asclepias subverticillata . (idaho.gov)
