A systemic infection of various salmonid and a few nonsalmonid fishes caused by Viral hemorrhagic septicemia virus (see NOVIRHABDOVIRUS),
A genus in the family RHABDOVIRIDAE, infecting numerous species of fish with broad geographic distribution. The type species is INFECTIOUS HEMATOPOIETIC NECROSIS VIRUS.
Any of several bacterial diseases, usually caused by PASTEURELLA MULTOCIDA, marked by the presence of hemorrhagic areas in the subcutaneous tissues, serous membranes, muscles, lymph glands, and throughout the internal organs. The diseases primarily affect animals and rarely humans.
Virus diseases caused by RHABDOVIRIDAE. Important infections include RABIES; EPHEMERAL FEVER; and vesicular stomatitis.
A family of bullet-shaped viruses of the order MONONEGAVIRALES, infecting vertebrates, arthropods, protozoa, and plants. Genera include VESICULOVIRUS; LYSSAVIRUS; EPHEMEROVIRUS; NOVIRHABDOVIRUS; Cytorhabdovirus; and Nucleorhabdovirus.
Diseases of freshwater, marine, hatchery or aquarium fish. This term includes diseases of both teleosts (true fish) and elasmobranchs (sharks, rays and skates).
A large stout-bodied, sometimes anadromous, TROUT found in still and flowing waters of the Pacific coast from southern California to Alaska. It has a greenish back, a whitish belly, and pink, red, or lavender stripes on the sides, with usually a sprinkling of black dots. It is highly regarded as a sport and food fish. Its former name was Salmo gairdneri. The sea-run rainbow trouts are often called steelheads. Redband trouts refer to interior populations of rainbows.
Common name for the order Pleuronectiformes. A very distinctive group in that during development they become asymmetrical, i.e., one eye migrates to lie adjacent to the other. They swim on the eyeless side. FLOUNDER, sole, and turbot, along with several others, are included in this order.
The geographic area of the Great Lakes in general and when the specific state or states are not indicated. It usually includes Illinois, Indiana, Michigan, Minnesota, New York, Ohio, Pennsylvania, and Wisconsin.
A group of cold-blooded, aquatic vertebrates having gills, fins, a cartilaginous or bony endoskeleton, and elongated bodies covered with scales.
Cultivation of natural faunal resources of water. (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)
A family of anadromous fish comprising SALMON; TROUT; whitefish; and graylings. They are the most important food and game fishes. Their habitat is the northern Atlantic and Pacific, both marine and inland, and the Great Lakes. (Nelson: Fishes of the World, 1976, p97)
The type species of NOVIRHABDOVIRUS, in the family RHABDOVIRIDAE. It is a major pathogen of TROUT and SALMON.
Infections with bacteria of the genus PASTEURELLA.
Common name for two families of FLATFISHES belonging to the order Pleuronectiformes: left-eye flounders (Bothidae) and right-eye flounders (Pleuronectidae). The latter is more commonly used in research.
Places for cultivation and harvesting of fish, particularly in sea waters. (from McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)
Membranous appendage of fish and other aquatic organisms used for locomotion or balance.
A species of EDWARDSIELLA distinguished by its hydrogen sulfide production. (From Bergey's Manual of Determinative Bacteriology, 9th ed)
A species of gram-negative, facultatively anaerobic, rod-shaped bacteria normally found in the flora of the mouth and respiratory tract of animals and birds. It causes shipping fever (see PASTEURELLOSIS, PNEUMONIC); HEMORRHAGIC BACTEREMIA; and intestinal disease in animals. In humans, disease usually arises from a wound infection following a bite or scratch from domesticated animals.
The oldest recognized genus of the family PASTEURELLACEAE. It consists of several species. Its organisms occur most frequently as coccobacillus or rod-shaped and are gram-negative, nonmotile, facultative anaerobes. Species of this genus are found in both animals and humans.
Fish of the genera ONCORHYNCHUS and Salmo in the family SALMONIDAE. They are anadromous game fish, frequenting the coastal waters of both the North Atlantic and Pacific. They are known for their gameness as a sport fish and for the quality of their flesh as a table fish. (Webster, 3d ed).
An enzyme of the shikimate pathway of AROMATIC AMINO ACID biosynthesis, it generates 5-enolpyruvylshikimate 3-phosphate and ORTHOPHOSPHATE from PHOSPHOENOLPYRUVATE and shikimate-3-phosphate. The shikimate pathway is present in BACTERIA and PLANTS but not in MAMMALS.
Systemic inflammatory response syndrome with a proven or suspected infectious etiology. When sepsis is associated with organ dysfunction distant from the site of infection, it is called severe sepsis. When sepsis is accompanied by HYPOTENSION despite adequate fluid infusion, it is called SEPTIC SHOCK.
A family of freshwater fish comprising the minnows or CARPS.
Paired respiratory organs of fishes and some amphibians that are analogous to lungs. They are richly supplied with blood vessels by which oxygen and carbon dioxide are exchanged directly with the environment.
The type species of AQUABIRNAVIRUS, causing infectious pancreatic necrosis in salmonid fish and other freshwater and marine animals including mollusks.
The most diversified of all fish orders and the largest vertebrate order. It includes many of the commonly known fish such as porgies, croakers, sunfishes, dolphin fish, mackerels, TUNA, etc.
Various fish of the family SALMONIDAE, usually smaller than salmon. They are mostly restricted to cool clear freshwater. Some are anadromous. They are highly regarded for their handsome colors, rich well-flavored flesh, and gameness as an angling fish. The genera Salvelinus, Salmo, and ONCORHYNCHUS have been introduced virtually throughout the world.
The placing of a body or a part thereof into a liquid.
Animals considered to be wild or feral or not adapted for domestic use. It does not include wild animals in zoos for which ANIMALS, ZOO is available.
While there isn't a specific medical definition for "North America," I can provide a geographical definition that is often used in public health and medical contexts: North America is the third largest continent by area, encompassing 23 independent states, including the United States, Canada, and Mexico, which are home to diverse populations, cultures, and ecosystems, and share common health-related challenges such as obesity, diabetes, and healthcare access disparities.
Descriptions of specific amino acid, carbohydrate, or nucleotide sequences which have appeared in the published literature and/or are deposited in and maintained by databanks such as GENBANK, European Molecular Biology Laboratory (EMBL), National Biomedical Research Foundation (NBRF), or other sequence repositories.
Water containing no significant amounts of salts, such as water from RIVERS and LAKES.
Layers of protein which surround the capsid in animal viruses with tubular nucleocapsids. The envelope consists of an inner layer of lipids and virus specified proteins also called membrane or matrix proteins. The outer layer consists of one or more types of morphological subunits called peplomers which project from the viral envelope; this layer always consists of glycoproteins.
The degree of pathogenicity within a group or species of microorganisms or viruses as indicated by case fatality rates and/or the ability of the organism to invade the tissues of the host. The pathogenic capacity of an organism is determined by its VIRULENCE FACTORS.
The salinated water of OCEANS AND SEAS that provides habitat for marine organisms.
The relationships of groups of organisms as reflected by their genetic makeup.
Proteins found in any species of virus.
A variation of the PCR technique in which cDNA is made from RNA via reverse transcription. The resultant cDNA is then amplified using standard PCR protocols.
The presence of viable bacteria circulating in the blood. Fever, chills, tachycardia, and tachypnea are common acute manifestations of bacteremia. The majority of cases are seen in already hospitalized patients, most of whom have underlying diseases or procedures which render their bloodstreams susceptible to invasion.
Sudden increase in the incidence of a disease. The concept includes EPIDEMICS and PANDEMICS.
Ribonucleic acid that makes up the genetic material of viruses.
The sequence of PURINES and PYRIMIDINES in nucleic acids and polynucleotides. It is also called nucleotide sequence.
Conjugated protein-carbohydrate compounds including mucins, mucoid, and amyloid glycoproteins.
The genetic constitution of the individual, comprising the ALLELES present at each GENETIC LOCUS.
The order of amino acids as they occur in a polypeptide chain. This is referred to as the primary structure of proteins. It is of fundamental importance in determining PROTEIN CONFORMATION.
Short sequences (generally about 10 base pairs) of DNA that are complementary to sequences of messenger RNA and allow reverse transcriptases to start copying the adjacent sequences of mRNA. Primers are used extensively in genetic and molecular biology techniques.
Immunoglobulins produced in response to VIRAL ANTIGENS.
An immunoassay utilizing an antibody labeled with an enzyme marker such as horseradish peroxidase. While either the enzyme or the antibody is bound to an immunosorbent substrate, they both retain their biologic activity; the change in enzyme activity as a result of the enzyme-antibody-antigen reaction is proportional to the concentration of the antigen and can be measured spectrophotometrically or with the naked eye. Many variations of the method have been developed.
Established cell cultures that have the potential to propagate indefinitely.

Studies on pathogenesis following single and double infection with viral hemorrhagic septicemia virus and infectious hematopoietic necrosis virus in rainbow trout (Oncorhynchus mykiss). (1/29)

Rainbow trout (Oncorhynchus mykiss) were bath challenged with viral hemorrhagic septicemia (VHS) virus or infectious hematopoietic necrosis (IHN) virus or with both viruses simultaneously. The viral distribution and development of histologic lesions were examined using immunohistochemistry, while virus titer in kidney was determined by viral titration in cell culture. Single infections with VHS virus and IHN virus showed similar distributions of virus in internal organs. The early identification of virus in gill epithelium, 1 and 2 days postinfection (PI) for VHS virus and IHN virus, respectively, indicates that this organ is the point of entry for both viruses. The detection of VHS virus at 1 day PI and 3 days PI for IHN virus is indicative of kidney and spleen being the target organs for these viruses. A simultaneous infection of VHS virus and IHN virus resulted in both viruses establishing an infection. Further double infection did not result in a statistically significant lower titer of both viruses in kidney but a more restricted distribution of IHN virus in internal organs compared with the single infected group. The most striking finding is that, for IHN virus, virus was not detected in the brain in situ in the double-infected group. This study provides support for the conclusion that simultaneous infection with two piscine rhabdoviruses in a susceptible host results in some degree of interaction at the cell level, leading to a reduced systemic distribution of IHN virus.  (+info)

Four years of monitoring for viral haemorrhagic septicaemia virus in marine waters around the United Kingdom. (2/29)

Between 1995 and 1998, marine fish from around the coast of the UK were collected and samples analysed for viral haemorrhagic septicaemia virus (VHSV) using cell culture isolation methods. In 1997 and 1998 the samples were also analysed for VHSV by reverse transcription PCR (RT-PCR). A total of 1867 fish of 11 species were tested, but VHSV was isolated on only 1 occasion, from herring Clupea harengus, in 1996. However, despite VHSV not being isolated in 1997 and 1998, in both years samples of herring from the west and south coasts of England produced positive signals in the RT-PCR, and in 1997 cod from the east coast of England also produced positive signals in the RT-PCR. These results are believed to be true indications of the presence of VHSV nucleic acid in the fish. In 1997, birnaviruses from Serogroup B1 were isolated from herring (a previously unrecorded host for the virus) and cod Gadus morhua, and a birnavirus from Serogroup A2 was also isolated from cod. In 1998, an aquareovirus was isolated from haddock Melanogrammus aeglefinus, a previously unrecorded host for the virus.  (+info)

Haematological analyses in rainbow trout Oncorhynchus mykiss affected by viral haemorrhagic septicaemia (VHS). (3/29)

Rainbow trout Oncorhynchus mykiss weighing 87 +/- 15 g (mean +/- SD) were infected with viral haemorrhagic septicaemia virus (VHSV) and the haematological and biochemical profiles of peripheral blood examined. Depending on the clinical signs and gross pathology, the fish were divided into 2 groups: Group A included fish in the acute stage, Group B comprised fish in the chronic stage. Red blood cells were subjected to 6 haematological tests and blood plasma to 14 biochemical tests, which provided findings on changed substrate concentrations and enzyme activities. Diseased fish, compared to healthy fish, had a significantly lower red blood cell count, and lower haematocrit and haemoglobin levels. As for the biochemical parameters, the fish had less total protein, creatinine, glucose, triacylglycerol, inorganic phosphate, total calcium and sodium, and more blood urea, nitrogen and potassium. Uric acid levels remained unchanged. Increases were recorded in the catalytic concentration of alanine aminotransferase, aspartate aminotransferase and lactate dehydrogenase. A decrease was recorded in the catalytic concentration of alkaline phosphatase. Fish with VHS in the chronic stage, compared with healthy fish, were in worse condition, with a significantly reduced Fulton coefficient and Clark coefficient, and a higher hepatosomatic index and visceral somatic index.  (+info)

Effect of intraperitoneally administered IL-1beta-derived peptides on resistance to viral haemorrhagic septicaemia in rainbow trout Oncorhynchus mykiss. (4/29)

The present work provides the first information concerning the immunostimulatory activity of trout interleukin (IL)-1beta-derived peptides in vivo. Previous studies have demonstrated the ability of 2 such peptides, referred to as P1 and P3, to up-regulate a range of important immune parameters in vitro. P1 corresponds to fragment 146-157 (YVTPVPIETEAR) of the trout sequence and is analogous to a biologically active mammalian IL-1beta-derived peptide, whilst P3 was synthesised to complex with the IL-1 receptor and corresponds to fragment 197-206 (YRRNTGVDIS) of the trout sequence. Optimal migration of peritoneal leucocytes, peptide induced phagocytosis and intracellular respiratory burst activity occurred following intraperitoneal injection of 3.0 micromol of P3. Furthermore, resistance to viral haemorrhagic septicaemia virus (VHSV) was soon augmented (2 d) post-injection of P3.  (+info)

Reversible inhibition of spreading of in vitro infection and imbalance of viral protein accumulation at low pH in viral hemorrhagic septicemia rhabdovirus, a salmonid rhabdovirus. (5/29)

The inhibition of viral hemorrhagic septicemia rhabdovirus (VHSV) in vitro infection by pHs of <7 (low pH) has been previously reported. Nevertheless, the details of the mechanism underlying this effect remain obscure. We present evidence showing that low-pH inhibition occurs during a viral postadsorption step. Thus, while VHSV bound, replicated within single cells, and presented its G protein on the membranes of infected cells at both low and physiological pHs, both cell-to-cell spreading of infection (as estimated by the appearance of foci of infected cells) and fusion (as estimated by a syncytium assay) were inhibited by this low pH. The decreased VHSV titers and the inhibition of both cell-to-cell spreading of infection and fusion could be reversed by adjusting the pH to 7.5 at any time during infection. This effect should be taken into account to avoid false negatives in the diagnosis of VHSV by cell culture. On the other hand, the cell-to-cell spreading of infection at pH 7.5 could be stopped at any time by reducing the pH to 6.5. Since at low pH there were changes in the protein G conformation and smaller and imbalanced amounts of N with respect to M1, M2, and G viral proteins, alterations of the assembly and/or budding of VHSV are most probably involved in the absence of newly released infective virions.  (+info)

Experimental infection of rainbow trout Oncorhynchus mykiss with viral haemorrhagic septicaemia virus isolates from European marine and farmed fishes. (6/29)

The susceptibility of rainbow trout Oncorhynchus mykiss to infection with various isolates of viral haemorrhagic septicaemia virus (VHSV) was examined. A total of 8 experiments with rainbow trout ranging from 0.6 to 6.2 g was conducted for 139 isolates originating from wild marine fishes in European waters (115 isolates), farmed turbot from Scotland and Ireland (2 isolates), and farmed rainbow trout (22 isolates). The isolates were tested by immersion and/or intraperitoneal injection either as pooled or single isolates. The isolates from wild marine fishes did not cause mortality by immersion while some of the isolates caused mortality when injected. All VHSV isolates from farmed rainbow trout caused significant mortality by immersion. Currently, pathogenicity trials are the only way to differentiate VHSV isolates from wild marine fishes and farmed rainbow trout. The 2 farmed turbot isolates did not cause mortality by immersion, supporting the view that they originated from the marine environment.  (+info)

Experimental horizontal transmission of viral hemorrhagic septicemia virus (VHSV) in Japanese flounder Paralichthys olivaceus. (7/29)

Infection by viral hemorrhagic septicemia virus (VHSV) has recently occurred among wild and farmed Japanese flounder Paralichthys olivaceus in Japan. In the present study, horizontal transmission of VHSV among Japanese flounder was experimentally demonstrated by immersion challenge. Exposure to a flounder isolate (Obama25) of VHSV revealed a dose-response, with higher mortality (81 and 70%) at the 2 higher exposure levels (6.0 and 4.0 log10 TCID50 ml(-1)). In a second experiment, high titers of VHSV were expressed from moribund and dead flounder based on virus detection in holding-tank waters 2 to 3 d prior to death of the fish and 1 d after death. The virus could not be detected in tank waters 2 d after death. Finally, a third cohabitation experiment in small tanks demonstrated horizontal transmission of VHSV from experimentally infected to uninfected fish.  (+info)

Sequential pathology after experimental infection with marine viral hemorrhagic septicemia virus isolates of low and high virulence in turbot (Scophthalmus maximus L). (8/29)

Three marine viral hemorrhagic septicemia virus isolates were used to bath challenge turbot with the purpose of studying mortality and the pathology and antigen distribution over time. Two high-virulence isolates, 860/94, 4p168 and a low-virulence isolate 1p3 from a Baltic Sea herring were used. Organ samples were collected sequentially at 2, 4, 7, 10, 15, 20, 25, and 45 days postinfection. Specimens were processed for virology, histopathology, and immunohistochemistry. Organs during the early stages of infection (from 2 to 7 days) had virus isolation from all three groups only on day 7. Virus titer in kidney and heart sampled at day 25 was higher for the two virulent isolates compared with the low-virulence isolate. The viral distribution in situ of the two more virulent isolates from turbot (860/94) and herring (4p168) resembled viral hemorrhagic septicemia in rainbow trout with regard to the target organs. Early infection of endothelial cells in both kidney and heart was observed. Accumulated mean mortality was 41.5% for the turbot isolate 860/94, 48% for the herring isolate 4p168, and 3.5% for the herring isolate 1p3. This study revealed that the isolates from turbot (860/94) and herring (4p168) induced significantly higher mortality compared with the virus-free control and the herring isolate (1p3). The onset of mortality is markedly later in turbot compared with what is seen in rainbow trout.  (+info)

Hemorrhagic Septicemia, Viral is not a recognized medical condition. However, Hemorrhagic Septicemia is a well-known disease in veterinary medicine, which can be caused by both bacterial and viral pathogens.

Bacterial Hemorrhagic Septicemia is primarily caused by Pasteurella multocida serotype B:2 and Escherichia coli. It is a severe, contagious disease in domestic and wild animals, particularly in cattle, buffalo, and water buffaloes. The disease is characterized by sudden onset of high fever, weakness, swelling of the throat, and profuse bleeding from various parts of the body.

On the other hand, Viral Hemorrhagic Septicemia (VHS) is a contagious viral disease that affects primarily fish. It is caused by the Viral Haemorrhagic Septicemia Virus (VHSV), which belongs to the family Rhabdoviridae and genus Novirhabdovirus. The virus infects over 50 species of freshwater and marine fish, causing severe hemorrhages, anemia, and often death.

Therefore, it is essential to clarify whether you are referring to Hemorrhagic Septicemia caused by a bacterial or viral agent before providing a specific definition.

Novirhabdovirus is not a medical term, but a taxonomic designation for a genus of viruses within the family Rhabdoviridae. These viruses are characterized by having a bullet-shaped virion and a single-stranded, negative-sense RNA genome. They infect a variety of hosts, including fish and birds, and can cause serious diseases. However, they are not known to infect humans or pose a direct threat to human health.

Hemorrhagic Septicemia is a severe, often fatal, bacterial disease primarily affecting domestic and wild cloven-hoofed animals (such as cattle, buffalo, sheep, and goats). It is characterized by septicemia (the presence of bacteria in the blood) and hemorrhages (bleeding) in various organs. The causative agents are typically gram-negative bacteria from the genus Pasteurella, primarily P. multocida serotype B:2 and sometimes other serotypes or related bacteria like Bibersteinia trehalosi.

The disease is transmitted through direct contact with infected animals or contaminated materials. It can also be spread through respiratory droplets during close contact. The incubation period ranges from a few hours to several days, and the disease progresses rapidly, often leading to death within 24-48 hours after the onset of clinical signs.

Clinical signs include high fever, depression, loss of appetite, rapid breathing, coughing, nasal discharge, swelling of the throat, and sudden death. In advanced stages, animals may show signs of severe hemorrhages in the mucous membranes, resulting in dark-colored urine and feces.

Prevention and control measures include vaccination, biosecurity practices, and rapid detection and isolation of infected animals to prevent further spread. Treatment is often challenging due to the rapid progression of the disease, but antibiotics may be used in early stages or for prophylaxis in high-risk situations.

Rhabdoviruses are negative-sense, single-stranded RNA viruses that belong to the family Rhabdoviridae. They have a wide host range, including humans, and can cause various diseases.

Rhabdoviridae infections refer to the infectious diseases caused by rhabdoviruses. The most well-known member of this family is the rabies virus, which causes rabies, a fatal zoonotic disease that affects warm-blooded animals, including humans. Rabies is transmitted through the saliva of infected animals, usually via bites or scratches.

Other rhabdoviruses can also cause human diseases, such as:

1. Vesicular stomatitis virus (VSV): It primarily affects livestock, causing vesicular lesions in the mouth and on the feet. However, it can also infect humans, causing flu-like symptoms or a rash around the mouth and hands.
2. Chandipura virus: This rhabdovirus is associated with acute encephalitis, particularly in children. It is transmitted through mosquitoes and has been identified in several countries, including India and Nigeria.
3. Human basalotid fibroblast growth factor (bFGF) receptor-binding virus: This recently discovered rhabdovirus was found to be associated with a case of acute respiratory illness. More research is needed to understand its epidemiology, transmission, and clinical significance.

Prevention and control measures for Rhabdoviridae infections include vaccination against rabies, public education on avoiding contact with potentially infected animals, and personal protective measures such as wearing gloves when handling animals or their tissues.

Rhabdoviridae is a family of negative-sense, single-stranded RNA viruses that include several important human and animal pathogens. The name "Rhabdoviridae" comes from the Greek word "rhabdos," meaning rod, which refers to the characteristic bullet shape of these virions.

The family Rhabdoviridae is divided into six genera: Vesiculovirus, Lyssavirus, Ephemerovirus, Novirhabdovirus, Cytorhabdovirus, and Sphericalvirus. The most well-known member of this family is the rabies virus, which belongs to the genus Lyssavirus.

Rhabdoviruses have a simple structure, consisting of an envelope surrounding a helical nucleocapsid that contains the RNA genome. The virions are typically 100-430 nm in length and 45-100 nm in diameter, with a central electron-dense core surrounded by a less dense matrix protein layer.

Rhabdoviruses infect a wide range of hosts, including mammals, birds, fish, reptiles, and insects. They typically cause acute infections characterized by fever, lethargy, and other nonspecific symptoms. In severe cases, rhabdovirus infections can lead to serious neurological disorders, such as encephalitis or meningitis, and can be fatal if left untreated.

Transmission of rhabdoviruses occurs through various routes, depending on the specific virus and host. For example, rabies virus is typically transmitted through the bite of an infected animal, while other rhabdoviruses may be spread through contact with contaminated bodily fluids or aerosols.

Prevention and control measures for rhabdovirus infections depend on the specific virus and host. For example, rabies vaccination is effective in preventing infection in humans and animals, while other rhabdoviruses may be controlled through quarantine measures, insect control, or antiviral therapy.

"Fish diseases" is a broad term that refers to various health conditions and infections affecting fish populations in aquaculture, ornamental fish tanks, or wild aquatic environments. These diseases can be caused by bacteria, viruses, fungi, parasites, or environmental factors such as water quality, temperature, and stress.

Some common examples of fish diseases include:

1. Bacterial diseases: Examples include furunculosis (caused by Aeromonas salmonicida), columnaris disease (caused by Flavobacterium columnare), and enteric septicemia of catfish (caused by Edwardsiella ictaluri).

2. Viral diseases: Examples include infectious pancreatic necrosis virus (IPNV) in salmonids, viral hemorrhagic septicemia virus (VHSV), and koi herpesvirus (KHV).

3. Fungal diseases: Examples include saprolegniasis (caused by Saprolegnia spp.) and cotton wool disease (caused by Aphanomyces spp.).

4. Parasitic diseases: Examples include ichthyophthirius multifiliis (Ich), costia, trichodina, and various worm infestations such as anchor worms (Lernaea spp.) and tapeworms (Diphyllobothrium spp.).

5. Environmental diseases: These are caused by poor water quality, temperature stress, or other environmental factors that weaken the fish's immune system and make them more susceptible to infections. Examples include osmoregulatory disorders, ammonia toxicity, and low dissolved oxygen levels.

It is essential to diagnose and treat fish diseases promptly to prevent their spread among fish populations and maintain healthy aquatic ecosystems. Preventative measures such as proper sanitation, water quality management, biosecurity practices, and vaccination can help reduce the risk of fish diseases in both farmed and ornamental fish settings.

Oncorhynchus mykiss is the scientific name for a species of fish that is commonly known as the Rainbow Trout. According to the medical or clinical definition provided by the US National Library of Medicine, Oncorhynchus mykiss is "a freshwater fish that is widely cultured and an important food source in many parts of the world." It is also a popular game fish and is often stocked in lakes and rivers for recreational fishing. Rainbow trout are native to cold-water tributaries that flow into the Pacific Ocean in Asia and North America. They have been introduced widely throughout the world and can now be found in freshwater systems on every continent except Antarctica. Rainbow trout are a valuable species for both commercial and recreational fisheries, and they also play an important role in the food web as both predators and prey.

Flatfishes are a group of marine fish characterized by having both eyes on one side of their head, which is flattened laterally. This gives them a distinctive asymmetrical appearance. They belong to the order Pleuronectiformes and include various species such as halibut, flounder, sole, and plaice. Flatfishes start their life with eyes on both sides of their head, but during development, one eye migrates to the other side of the head, a process known as metamorphosis. They are bottom-dwelling predators that rely on their excellent camouflage abilities to ambush prey.

I'm sorry for any confusion, but "Great Lakes Region" is not a medical term. It generally refers to a geographical region in North America, comprising eight U.S. states and the Canadian province of Ontario around the Great Lakes. These are Michigan, Wisconsin, Minnesota, Illinois, Indiana, Ohio, Pennsylvania, and New York. If you have any medical terms you'd like defined, I'd be happy to help!

I believe there may be a misunderstanding in your question. The term "fishes" is not typically used in a medical context. "Fish" or "fishes" refers to any aquatic organism belonging to the taxonomic class Actinopterygii (bony fish), Chondrichthyes (sharks and rays), or Agnatha (jawless fish).

However, if you are referring to a condition related to fish or consuming fish, there is a medical issue called scombroid fish poisoning. It's a foodborne illness caused by eating spoiled or improperly stored fish from the Scombridae family, which includes tuna, mackerel, and bonito, among others. The bacteria present in these fish can produce histamine, which can cause symptoms like skin flushing, headache, diarrhea, and itchy rash. But again, this is not related to the term "fishes" itself but rather a condition associated with consuming certain types of fish.

Aquaculture is the controlled cultivation and farming of aquatic organisms, such as fish, crustaceans, mollusks, and aquatic plants, in both freshwater and saltwater environments. It involves the breeding, rearing, and harvesting of these organisms under controlled conditions to produce food, feed, recreational resources, and other products for human use. Aquaculture can take place in a variety of systems, including ponds, raceways, tanks, and cages, and it is an important source of protein and livelihoods for many people around the world.

"Salmonidae" is not a medical term. It is a biological term that refers to a family of fish which includes salmon, trout, char, grayling, and whitefish. These fish are often anadromous, meaning they are born in fresh water, migrate to the ocean, then return to fresh water to reproduce. They are important both commercially and recreationally as a source of food and sport fishing.

Infectious Hematopoietic Necrosis Virus (IHNV) is a species of negative-sense single-stranded RNA virus that belongs to the family Novirhabdoviridae. It is the causative agent of infectious hematopoietic necrosis (IHN), a serious and highly contagious disease in salmonid fish such as rainbow trout, sockeye salmon, and Atlantic salmon.

The virus primarily infects the hematopoietic tissue in the kidney, spleen, and liver of the host fish, leading to necrosis (cell death) and subsequent damage to the immune system. IHNV can cause significant mortality rates in infected fish populations, particularly in young fish, and poses a major threat to the aquaculture industry.

IHNV is transmitted horizontally through direct contact with infected fish or their bodily fluids, as well as vertically from infected broodstock to offspring. The virus can also be spread through contaminated water, equipment, and other fomites. Prevention and control measures include strict biosecurity protocols, vaccination of fish stocks, and the use of disinfectants to eliminate the virus from contaminated surfaces and equipment.

Pasteurella infections are diseases caused by bacteria belonging to the genus Pasteurella, with P. multocida being the most common species responsible for infections in humans. These bacteria are commonly found in the upper respiratory tract and gastrointestinal tracts of animals, particularly domestic pets such as cats and dogs.

Humans can acquire Pasteurella infections through animal bites, scratches, or contact with contaminated animal secretions like saliva. The infection can manifest in various forms, including:

1. Skin and soft tissue infections: These are the most common types of Pasteurella infections, often presenting as cellulitis, abscesses, or wound infections after an animal bite or scratch.
2. Respiratory tract infections: Pasteurella bacteria can cause pneumonia, bronchitis, and other respiratory tract infections, especially in individuals with underlying lung diseases or weakened immune systems.
3. Ocular infections: Pasteurella bacteria can infect the eye, causing conditions like conjunctivitis, keratitis, or endophthalmitis, particularly after an animal scratch to the eye or face.
4. Septicemia: In rare cases, Pasteurella bacteria can enter the bloodstream and cause septicemia, a severe and potentially life-threatening condition.
5. Other infections: Pasteurella bacteria have also been known to cause joint infections (septic arthritis), bone infections (osteomyelitis), and central nervous system infections (meningitis or brain abscesses) in some cases.

Prompt diagnosis and appropriate antibiotic treatment are crucial for managing Pasteurella infections, as they can progress rapidly and lead to severe complications, particularly in individuals with compromised immune systems.

I'm sorry for any confusion, but "flounder" is not a medical term. It is a common name used for several species of flatfish that are widely consumed as food. If you have any questions about medical terminology or health-related topics, please don't hesitate to ask!

I'm sorry for any confusion, but "Fisheries" is not a term typically used in medical definitions. Fisheries are places or practices concerned with the catching, processing, or selling of fish, shellfish, and other forms of aquatic life. They can refer to commercial operations, recreational activities, or scientific research related to aquatic species. If you have any questions about medical terminology or concepts, I'd be happy to help answer those for you!

I could not find a medical definition for "animal fins" as a single concept. However, in the field of comparative anatomy and evolutionary biology, fins are specialized limbs that some aquatic animals use for movement, stability, or sensory purposes. Fins can be found in various forms among different animal groups, including fish, amphibians, reptiles, and even mammals like whales and dolphins.

Fins consist of either bony or cartilaginous structures that support webs of skin or connective tissue. They may contain muscles, blood vessels, nerves, and sensory organs, which help animals navigate their underwater environment efficiently. The specific structure and function of fins can vary greatly depending on the animal's taxonomic group and lifestyle adaptations.

In a medical context, studying animal fins could provide insights into the evolution of limbs in vertebrates or contribute to the development of biomimetic technologies inspired by nature. However, there is no standalone medical definition for 'animal fins.'

'Edwardsiella tarda' is a gram-negative, rod-shaped bacterium that can cause various infections in humans, animals, and fish. It is named after Francis E. Edwards, an American microbiologist who first isolated the bacterium in 1965. The bacterium is found in aquatic environments, including freshwater and brackish water, as well as in the intestines of animals and fish.

In humans, 'E. tarda' can cause a range of infections, including gastroenteritis, wound infections, meningitis, and sepsis. The bacterium is often associated with exposure to contaminated water or food, particularly raw or undercooked seafood. People with weakened immune systems, such as those with liver disease or cancer, are at higher risk of developing severe infections.

Treatment for 'E. tarda' infections typically involves antibiotics, such as ciprofloxacin or trimethoprim-sulfamethoxazole. Prevention measures include practicing good hygiene, avoiding consumption of raw or undercooked seafood, and promptly treating any wounds that come into contact with contaminated water.

"Pasteurella multocida" is a gram-negative, facultatively anaerobic, coccobacillus bacterium that is part of the normal flora in the respiratory tract of many animals, including birds, dogs, and cats. It can cause a variety of infections in humans, such as respiratory infections, skin and soft tissue infections, and bloodstream infections, particularly in individuals who have close contact with animals or animal bites or scratches. The bacterium is named after Louis Pasteur, who developed a vaccine against it in the late 19th century.

"Pasteurella" is a genus of Gram-negative, facultatively anaerobic coccobacilli that are part of the family Pasteurellaceae. These bacteria are commonly found as normal flora in the upper respiratory tracts of animals, including cats, dogs, and livestock. They can cause a variety of infections in humans, such as wound infections, pneumonia, and septicemia, often following animal bites or scratches. Two notable species are Pasteurella multocida and Pasteurella canis. Proper identification and antibiotic susceptibility testing are essential for appropriate treatment.

I'm sorry for any confusion, but "Salmon" is not a medical term. It is a common name for various species of fish that belong to the family Salmonidae and are known for their distinctive pink or red flesh. They are an important source of food and are popular in many cuisines around the world. If you have any questions about medical terminology, I'd be happy to help with those instead!

3-Phosphoshikimate 1-Carboxyvinyltransferase (PCT) is an enzyme that catalyzes the sixth step in the biosynthesis of aromatic amino acids in plants and microorganisms. The reaction it catalyzes is the conversion of 3-phosphoshikimate (3PSM) and phosphoenolpyruvate (PEP) to 5-enolpyruvylshikimate-3-phosphate (EPSP). This step is a key control point in the aromatic amino acid biosynthetic pathway, and the enzyme is the target of several herbicides, including glyphosate. The gene that encodes this enzyme is also used as a molecular marker for plant systematics and evolutionary studies.

Sepsis is a life-threatening condition that arises when the body's response to an infection injures its own tissues and organs. It is characterized by a whole-body inflammatory state (systemic inflammation) that can lead to blood clotting issues, tissue damage, and multiple organ failure.

Sepsis happens when an infection you already have triggers a chain reaction throughout your body. Infections that lead to sepsis most often start in the lungs, urinary tract, skin, or gastrointestinal tract.

Sepsis is a medical emergency. If you suspect sepsis, seek immediate medical attention. Early recognition and treatment of sepsis are crucial to improve outcomes. Treatment usually involves antibiotics, intravenous fluids, and may require oxygen, medication to raise blood pressure, and corticosteroids. In severe cases, surgery may be required to clear the infection.

Cyprinidae is a family of fish that includes carps, minnows, and barbs. It is the largest family of freshwater fish, with over 2,400 species found worldwide, particularly in Asia and Europe. These fish are characterized by their lack of teeth on the roof of their mouths and have a single dorsal fin. Some members of this family are economically important as food fish or for aquarium trade.

Gills are specialized respiratory organs found in many aquatic organisms such as fish, crustaceans, and some mollusks. They are typically thin, feathery structures that increase the surface area for gas exchange between the water and the animal's bloodstream. Gills extract oxygen from water while simultaneously expelling carbon dioxide.

In fish, gills are located in the gill chamber, which is covered by opercula or protective bony flaps. Water enters through the mouth, flows over the gills, and exits through the opercular openings. The movement of water over the gills allows for the diffusion of oxygen and carbon dioxide across the gill filaments and lamellae, which are the thin plates where gas exchange occurs.

Gills contain a rich supply of blood vessels, allowing for efficient transport of oxygen to the body's tissues and removal of carbon dioxide. The counter-current flow of water and blood in the gills ensures that the concentration gradient between the water and the blood is maximized, enhancing the efficiency of gas exchange.

Infectious pancreatic necrosis (IPN) is a viral disease that primarily affects young salmonid fish, such as salmon and trout. The IPN virus, also known as Salmonid alphavirus (SAV), is the causative agent of this disease. It is an enveloped, positive-sense single-stranded RNA virus belonging to the family Alphaflexiviridae and genus Alphavirus.

The IPN virus primarily targets the exocrine pancreas, leading to severe necrosis (tissue death) in infected fish. The infection can also spread to other organs, including the liver, kidney, and heart. Infected fish may exhibit various clinical signs such as lethargy, loss of appetite, darkening of the skin, abnormal swimming behavior, and exophthalmia (bulging eyes).

The IPN virus is highly contagious and can be transmitted horizontally through direct contact with infected fish or their bodily fluids. It can also be vertically transmitted from infected broodstock to their offspring. The disease can have significant economic impacts on the aquaculture industry, leading to high mortality rates in affected fish populations.

Prevention and control measures for IPN include vaccination of broodstock and fry, biosecurity practices, and quarantine procedures. There is no specific treatment for IPN, and antibiotics are generally not effective against viral infections. Supportive care, such as providing optimal water quality and nutrition, can help affected fish recover from the disease.

I'm sorry for any confusion, but "Perciformes" is not a medical term. It is a term used in the field of biology, specifically in taxonomy and ichthyology (the study of fish). Perciformes is an order of ray-finned bony fishes that includes over 10,000 species, making it the largest order of vertebrates. Examples of fish within this order include perch, sea bass, sunfish, and tuna.

I'm sorry for any confusion, but "trout" is not a term typically used in medical definitions. Trout is a common name that refers to several species of freshwater fish belonging to the salmonid family. If you have any questions related to medical terminology or health concerns, I would be happy to try and help answer those for you.

In medical terms, "immersion" is not a term with a specific clinical definition. However, in general terms, immersion refers to the act of placing something or someone into a liquid or environment completely. In some contexts, it may be used to describe a type of wound care where the wound is covered completely with a medicated dressing or solution. It can also be used to describe certain medical procedures or therapies that involve submerging a part of the body in a liquid, such as hydrotherapy.

Wild animals are those species of animals that are not domesticated or tamed by humans and live in their natural habitats without regular human intervention. They can include a wide variety of species, ranging from mammals, birds, reptiles, amphibians, fish, to insects and other invertebrates.

Wild animals are adapted to survive in specific environments and have behaviors, physical traits, and social structures that enable them to find food, shelter, and mates. They can be found in various habitats such as forests, grasslands, deserts, oceans, rivers, and mountains. Some wild animals may come into contact with human populations, particularly in urban areas where their natural habitats have been destroyed or fragmented.

It is important to note that the term "wild" does not necessarily mean that an animal is aggressive or dangerous. While some wild animals can be potentially harmful to humans if provoked or threatened, many are generally peaceful and prefer to avoid contact with people. However, it is essential to respect their natural behaviors and habitats and maintain a safe distance from them to prevent any potential conflicts or harm to either party.

I'm sorry for any confusion, but "North America" is not a medical term. It is a geographical term that refers to the third largest continent in the world, which includes countries such as the United States, Canada, and Mexico, among others. If you have any questions related to medical terminology or health topics, I'd be happy to help with those!

Molecular sequence data refers to the specific arrangement of molecules, most commonly nucleotides in DNA or RNA, or amino acids in proteins, that make up a biological macromolecule. This data is generated through laboratory techniques such as sequencing, and provides information about the exact order of the constituent molecules. This data is crucial in various fields of biology, including genetics, evolution, and molecular biology, allowing for comparisons between different organisms, identification of genetic variations, and studies of gene function and regulation.

I'm sorry for any confusion, but "Fresh Water" is not a medical term. It is a term used to describe water that contains low concentrations of dissolved salts and other dissolved minerals. It is distinguished from saline water, which includes saltwater found in the ocean and brackish water found in estuaries. Fresh water is essential for many biological processes and is the primary source of water for human consumption, agriculture, and industrial use.

Viral envelope proteins are structural proteins found in the envelope that surrounds many types of viruses. These proteins play a crucial role in the virus's life cycle, including attachment to host cells, fusion with the cell membrane, and entry into the host cell. They are typically made up of glycoproteins and are often responsible for eliciting an immune response in the host organism. The exact structure and function of viral envelope proteins vary between different types of viruses.

Virulence, in the context of medicine and microbiology, refers to the degree or severity of damage or harm that a pathogen (like a bacterium, virus, fungus, or parasite) can cause to its host. It is often associated with the ability of the pathogen to invade and damage host tissues, evade or suppress the host's immune response, replicate within the host, and spread between hosts.

Virulence factors are the specific components or mechanisms that contribute to a pathogen's virulence, such as toxins, enzymes, adhesins, and capsules. These factors enable the pathogen to establish an infection, cause tissue damage, and facilitate its transmission between hosts. The overall virulence of a pathogen can be influenced by various factors, including host susceptibility, environmental conditions, and the specific strain or species of the pathogen.

Seawater is not a medical term, but it is a type of water that covers more than 70% of the Earth's surface. Medically, seawater can be relevant in certain contexts, such as in discussions of marine biology, environmental health, or water safety. Seawater has a high salt content, with an average salinity of around 3.5%, which is much higher than that of freshwater. This makes it unsuitable for drinking or irrigation without desalination.

Exposure to seawater can also have medical implications, such as in cases of immersion injuries, marine envenomations, or waterborne illnesses. However, there is no single medical definition of seawater.

Phylogeny is the evolutionary history and relationship among biological entities, such as species or genes, based on their shared characteristics. In other words, it refers to the branching pattern of evolution that shows how various organisms have descended from a common ancestor over time. Phylogenetic analysis involves constructing a tree-like diagram called a phylogenetic tree, which depicts the inferred evolutionary relationships among organisms or genes based on molecular sequence data or other types of characters. This information is crucial for understanding the diversity and distribution of life on Earth, as well as for studying the emergence and spread of diseases.

Viral proteins are the proteins that are encoded by the viral genome and are essential for the viral life cycle. These proteins can be structural or non-structural and play various roles in the virus's replication, infection, and assembly process. Structural proteins make up the physical structure of the virus, including the capsid (the protein shell that surrounds the viral genome) and any envelope proteins (that may be present on enveloped viruses). Non-structural proteins are involved in the replication of the viral genome and modulation of the host cell environment to favor viral replication. Overall, a thorough understanding of viral proteins is crucial for developing antiviral therapies and vaccines.

Reverse Transcriptase Polymerase Chain Reaction (RT-PCR) is a laboratory technique used in molecular biology to amplify and detect specific DNA sequences. This technique is particularly useful for the detection and quantification of RNA viruses, as well as for the analysis of gene expression.

The process involves two main steps: reverse transcription and polymerase chain reaction (PCR). In the first step, reverse transcriptase enzyme is used to convert RNA into complementary DNA (cDNA) by reading the template provided by the RNA molecule. This cDNA then serves as a template for the PCR amplification step.

In the second step, the PCR reaction uses two primers that flank the target DNA sequence and a thermostable polymerase enzyme to repeatedly copy the targeted cDNA sequence. The reaction mixture is heated and cooled in cycles, allowing the primers to anneal to the template, and the polymerase to extend the new strand. This results in exponential amplification of the target DNA sequence, making it possible to detect even small amounts of RNA or cDNA.

RT-PCR is a sensitive and specific technique that has many applications in medical research and diagnostics, including the detection of viruses such as HIV, hepatitis C virus, and SARS-CoV-2 (the virus that causes COVID-19). It can also be used to study gene expression, identify genetic mutations, and diagnose genetic disorders.

Bacteremia is the presence of bacteria in the bloodstream. It is a medical condition that occurs when bacteria from another source, such as an infection in another part of the body, enter the bloodstream. Bacteremia can cause symptoms such as fever, chills, and rapid heart rate, and it can lead to serious complications such as sepsis if not treated promptly with antibiotics.

Bacteremia is often a result of an infection elsewhere in the body that allows bacteria to enter the bloodstream. This can happen through various routes, such as during medical procedures, intravenous (IV) drug use, or from infected wounds or devices that come into contact with the bloodstream. In some cases, bacteremia may also occur without any obvious source of infection.

It is important to note that not all bacteria in the bloodstream cause harm, and some people may have bacteria in their blood without showing any symptoms. However, if bacteria in the bloodstream multiply and cause an immune response, it can lead to bacteremia and potentially serious complications.

A disease outbreak is defined as the occurrence of cases of a disease in excess of what would normally be expected in a given time and place. It may affect a small and localized group or a large number of people spread over a wide area, even internationally. An outbreak may be caused by a new agent, a change in the agent's virulence or host susceptibility, or an increase in the size or density of the host population.

Outbreaks can have significant public health and economic impacts, and require prompt investigation and control measures to prevent further spread of the disease. The investigation typically involves identifying the source of the outbreak, determining the mode of transmission, and implementing measures to interrupt the chain of infection. This may include vaccination, isolation or quarantine, and education of the public about the risks and prevention strategies.

Examples of disease outbreaks include foodborne illnesses linked to contaminated food or water, respiratory infections spread through coughing and sneezing, and mosquito-borne diseases such as Zika virus and West Nile virus. Outbreaks can also occur in healthcare settings, such as hospitals and nursing homes, where vulnerable populations may be at increased risk of infection.

A viral RNA (ribonucleic acid) is the genetic material found in certain types of viruses, as opposed to viruses that contain DNA (deoxyribonucleic acid). These viruses are known as RNA viruses. The RNA can be single-stranded or double-stranded and can exist as several different forms, such as positive-sense, negative-sense, or ambisense RNA. Upon infecting a host cell, the viral RNA uses the host's cellular machinery to translate the genetic information into proteins, leading to the production of new virus particles and the continuation of the viral life cycle. Examples of human diseases caused by RNA viruses include influenza, COVID-19 (SARS-CoV-2), hepatitis C, and polio.

A base sequence in the context of molecular biology refers to the specific order of nucleotides in a DNA or RNA molecule. In DNA, these nucleotides are adenine (A), guanine (G), cytosine (C), and thymine (T). In RNA, uracil (U) takes the place of thymine. The base sequence contains genetic information that is transcribed into RNA and ultimately translated into proteins. It is the exact order of these bases that determines the genetic code and thus the function of the DNA or RNA molecule.

Glycoproteins are complex proteins that contain oligosaccharide chains (glycans) covalently attached to their polypeptide backbone. These glycans are linked to the protein through asparagine residues (N-linked) or serine/threonine residues (O-linked). Glycoproteins play crucial roles in various biological processes, including cell recognition, cell-cell interactions, cell adhesion, and signal transduction. They are widely distributed in nature and can be found on the outer surface of cell membranes, in extracellular fluids, and as components of the extracellular matrix. The structure and composition of glycoproteins can vary significantly depending on their function and location within an organism.

Genotype, in genetics, refers to the complete heritable genetic makeup of an individual organism, including all of its genes. It is the set of instructions contained in an organism's DNA for the development and function of that organism. The genotype is the basis for an individual's inherited traits, and it can be contrasted with an individual's phenotype, which refers to the observable physical or biochemical characteristics of an organism that result from the expression of its genes in combination with environmental influences.

It is important to note that an individual's genotype is not necessarily identical to their genetic sequence. Some genes have multiple forms called alleles, and an individual may inherit different alleles for a given gene from each parent. The combination of alleles that an individual inherits for a particular gene is known as their genotype for that gene.

Understanding an individual's genotype can provide important information about their susceptibility to certain diseases, their response to drugs and other treatments, and their risk of passing on inherited genetic disorders to their offspring.

An amino acid sequence is the specific order of amino acids in a protein or peptide molecule, formed by the linking of the amino group (-NH2) of one amino acid to the carboxyl group (-COOH) of another amino acid through a peptide bond. The sequence is determined by the genetic code and is unique to each type of protein or peptide. It plays a crucial role in determining the three-dimensional structure and function of proteins.

DNA primers are short single-stranded DNA molecules that serve as a starting point for DNA synthesis. They are typically used in laboratory techniques such as the polymerase chain reaction (PCR) and DNA sequencing. The primer binds to a complementary sequence on the DNA template through base pairing, providing a free 3'-hydroxyl group for the DNA polymerase enzyme to add nucleotides and synthesize a new strand of DNA. This allows for specific and targeted amplification or analysis of a particular region of interest within a larger DNA molecule.

Antibodies, viral are proteins produced by the immune system in response to an infection with a virus. These antibodies are capable of recognizing and binding to specific antigens on the surface of the virus, which helps to neutralize or destroy the virus and prevent its replication. Once produced, these antibodies can provide immunity against future infections with the same virus.

Viral antibodies are typically composed of four polypeptide chains - two heavy chains and two light chains - that are held together by disulfide bonds. The binding site for the antigen is located at the tip of the Y-shaped structure, formed by the variable regions of the heavy and light chains.

There are five classes of antibodies in humans: IgA, IgD, IgE, IgG, and IgM. Each class has a different function and is distributed differently throughout the body. For example, IgG is the most common type of antibody found in the bloodstream and provides long-term immunity against viruses, while IgA is found primarily in mucous membranes and helps to protect against respiratory and gastrointestinal infections.

In addition to their role in the immune response, viral antibodies can also be used as diagnostic tools to detect the presence of a specific virus in a patient's blood or other bodily fluids.

An Enzyme-Linked Immunosorbent Assay (ELISA) is a type of analytical biochemistry assay used to detect and quantify the presence of a substance, typically a protein or peptide, in a liquid sample. It takes its name from the enzyme-linked antibodies used in the assay.

In an ELISA, the sample is added to a well containing a surface that has been treated to capture the target substance. If the target substance is present in the sample, it will bind to the surface. Next, an enzyme-linked antibody specific to the target substance is added. This antibody will bind to the captured target substance if it is present. After washing away any unbound material, a substrate for the enzyme is added. If the enzyme is present due to its linkage to the antibody, it will catalyze a reaction that produces a detectable signal, such as a color change or fluorescence. The intensity of this signal is proportional to the amount of target substance present in the sample, allowing for quantification.

ELISAs are widely used in research and clinical settings to detect and measure various substances, including hormones, viruses, and bacteria. They offer high sensitivity, specificity, and reproducibility, making them a reliable choice for many applications.

A cell line is a culture of cells that are grown in a laboratory for use in research. These cells are usually taken from a single cell or group of cells, and they are able to divide and grow continuously in the lab. Cell lines can come from many different sources, including animals, plants, and humans. They are often used in scientific research to study cellular processes, disease mechanisms, and to test new drugs or treatments. Some common types of human cell lines include HeLa cells (which come from a cancer patient named Henrietta Lacks), HEK293 cells (which come from embryonic kidney cells), and HUVEC cells (which come from umbilical vein endothelial cells). It is important to note that cell lines are not the same as primary cells, which are cells that are taken directly from a living organism and have not been grown in the lab.

Viral hemorrhagic septicemia (VHS) is a deadly infectious fish disease caused by Viral hemorrhagic septicemia virus. It ... "Viral Haemorrhagic Septicaemia". WikiVet. Retrieved 11 October 2011. Groocock GH (2007). "Viral Hemorrhagic Septicemia and ... "Viral Hemorrhagic Septicemia (VHS) in New York". New York State Department of Environmental Conservation. Archived from the ... McAllister PE (1990). "Viral Hemorrhagic Septicemia of Fishes". Fish Disease Leaflet. United States Department of the Interior ...
Viral Hemorrhagic Septicemia. blockquote {border-left: 5px solid #fff;}. What is VHS and VHSv? Viral Hemorrhagic Septicemia ( ...
... to viral hemorrhagic septicemia, genogroup IVa (VHS) was indicated by controlled exposure studies where cumulative mortalities ... cumulative mortalities after waterborne exposure to viral hemorrhagic septicemia virus (VHSV) were 78%, 40%, and 13%, ... viral shedding rates, and viral persistence in survivors were greatest at the coolest exposure temperatures. Among groups of ... Similarly, geometric mean viral titers in brain tissues and kidney/spleen tissue pools decreased at higher temperatures, and ...
Viral Hemorrhagic Septicemia (VHS) virus, which has invaded the Great Lakes, is a potential threat in the Western US, according ... Viral hemorrhagic septicemia (VHS) is a disease caused by a virus (VHSV). There are different strains of the virus that can ... Viral Hemorrhagic Septicemia (VHS) virus, which has invaded the Great Lakes, is a potential threat in the Western US, according ... Viral Hemorrhagic Septicemia. -http://www.aphis.usda.gov/newsroom/hot_issues/vhs/vhs.shtml ...
Viral Hemorrhagic Septicemia (VHS) is a deadly fish virus that was first discovered in Lake Winnebago in 2006. Its not a ... Viral Hemorrhagic Septicemia (VHS) is a deadly fish virus and an invasive species that is threatening Wisconsins fish. VHS was ...
Do microRNAs induced by Viral Hemorrhagic Septicemia virus in rainbow trout (Oncorhynchus mykiss) possess anti-viral activity? ... Do microRNAs induced by Viral Hemorrhagic Septicemia virus in rainbow trout (Oncorhynchus mykiss) possess anti-viral activity ...
Viral Hemorrhagic Septicemia Virus (VHSV) - MMFS Fish Virus - Viral Hemorrhagic Septicemia Virus (VHSV) ...
This family consists of several viral hemorrhagic septicemia virus non-virion (Nv) proteins ... TS 122 Viral hemorrhagic septicemia virus Q1AEQ5 81 THYMFRNIPSSPAITGRRSDPELIIISHAEMMILTSGSESTS 122 Viral hemorrhagic septicemia ... Viral hemorrhagic septicemia virus non-virion protein. This family consists of several viral hemorrhagic septicemia virus non- ... Q1AES6 1 MATQPALSTTSFSPLVLREMITHRLKFDPSNYLNCDLDRSDISPVDFFETTLPRILDDLRASTRLPHLHVLDMRISLLER 80 Viral hemorrhagic sep... Q1AEQ5 1 ...
... viral hemorrhagic septicemia virus, AB672614; snakehead rhabdovirus, NC 000903; infectious hematopoietic necrosis virus, L40883 ...
Viral hemorrhagic septicemia virus (VHSV), a fish rhabdovirus belonging to the Novirhabdovirus genus, causes severe disease and ... Wolf K. (1988). Viral hemorrhagic septicemia. In: Fish Viruses and Fish Viral Diseases. , Cornell University Press, Ithaca, New ... Smail DA, Snow M. Viral haemorrhagic septicaemia. 2011. In: Woo PTK, Bruno DW, eds. Fish diseases and disorders, Vol. 3, Viral ... Viral hemorrhagic septicemia virus infection in yellow perch, Perca flavesens, in Lake Erie. J Great Lakes Res. 2010;36:37-43. ...
Viral hemorrhagic septicemia, testing, Minn. Statutes 2010 17.4993. Net pen aquaculture, water quality reports, Minn. Statutes ...
AIS Control Plan: Viral Hemorrhagic Septicemia [PDF, 246 KB] * Nov 2020. * Pennsylvania Fish and Boat Commission. ...
Viral Hemorrhagic Septicemia: A Threat to Colorados Fish [PDF, 689 KB] * Colorado Parks and Wildlife. ...
... septicemia and myelodysplasia were other common causes. Two patients were the suspected cases of viral hemorrhagic fever. ... septicemia and myelodysplasia were other common causes. Two patients were the suspected cases of viral hemorrhagic fever. ... and also seen in conjunction with hemolytic anemia and septicemia. Hypersplenism secondary to portal hypertension (cirrhosis) ... and also seen in conjunction with hemolytic anemia and septicemia. Hypersplenism secondary to portal hypertension (cirrhosis) ...
Viral hemorrhagic septicemia, control, Minn. Statutes 2018 17.4985 to 2018 17.4993, 2018 97C.342 ...
Viral Hemorrhagic Septicemia - Wikipedia. Zebra Mussel - U.S. Geological Survey Nonindigenous aquatic species. Spiny waterflea ...
The basis of pathogenicity of viral haemorrhagic septicaemia virus (VHSV) was analysed in the transcriptome of a rainbow trout ... The basis of pathogenicity of viral haemorrhagic septicaemia virus (VHSV) was analysed in the transcriptome of a rainbow trout ... Evidence of Transcriptional Shutoff by Pathogenic Viral Haemorrhagic Septicaemia Virus in Rainbow Trout. ... Evidence of Transcriptional Shutoff by Pathogenic Viral Haemorrhagic Septicaemia Virus in Rainbow Trout. ...
The name even sounds scary: viral hemorrhagic septicemia. It causes fish to bleed to. death. ... septicemia, sick, sickness, spread, spreading, unhealthy, unsafe, vhs, viral, virus, water New Polar Bear Rule for Oil. *. Oil ... Categories News SpotsTags bacteria, basin, bleed, bleeding, death, die, dying, fish, glft, great, health, healthy, hemorrhagic ...
... viral Haemorrhagic Septicaemia virus). Further detail ...
... viral Haemorrhagic Septicaemia virus). Further detail ...
... viral Haemorrhagic Septicaemia virus). Further detail ...
The suspected cause is viral hemorrhagic septicemia, a disease known from other Pacific fish species. Again, no mention in the ... Of course it went viral.. Since I believe in open, honest discourse, let me begin by pointing out that I am not a physicist, ... Coming on the heels of these new reports is a viral blog post entitled 28 Signs That The West Coast Is Being Absolutely Fried ... Do we really need to blame Fukushima on a viral outbreak in British Columbia, too? ...
Channel catfish are one species that is susceptible to viral hemorrhagic septicemia (VHS), which can decimate fish populations. ...
Viral Hemorrhagic Septicemia virus (VHSv). Hemorrhagic septicemia. X. *HPR0 is a non-virulent form of ISA-virus ...
2013). Epidemiology and Control of an Outbreak of Viral Haemorrhagic Septicaemia in Wrasse Around Shetland Commencing 2012. ... to viral haemorrhagic septicaemia virus (VHSV) genotype III: experimental challenge and pathology. Veterinary Microbiology 186 ... to viral haemorrhagic septicaemia virus (VHSV) genotype III: experimental challenge and pathology. Veterinary Microbiology 186 ... Development of a sensitive and controlled real-time RT-PCR assay to screen for the presence of viral haemorrhagic septicaemia ...
The olive leaf extract exhibits antiviral activity against viral haemorrhagic septicaemia rhabdovirus (VHSV). Antivir Res 66(2- ...
The Great Lakes "viral hemorrhagic septicemia virus" (VHSV) poses no health threat to humans, but people should always avoid ...
Hershberger, P.K., Kocan, R.M., Elder, N.E., Meyers, T.R., & Winton, J.R. (1999). pizootiology of viral hemorrhagic septicemia ...
4. Viral haemorrhagic septicaemia.. 5. Infectious pancreatic necrosis.. 6. Infectious salmon anaemia. ...

No FAQ available that match "hemorrhagic septicemia viral"

No images available that match "hemorrhagic septicemia viral"